POMC-derived 39-AA peptide hormone
A 39-residue peptide hormone derived from the POMC precursor. The canonical reference standard for melanocortin (MC2R) and HPA-axis research.
| Compound | ACTH 1-39 |
| Research category | Other Research |
| Available sizes | 5mg |
| Pricing | From £30 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic 39-amino-acid corticotropin (ACTH 1-39) |
| Molecular formula | C207H308N56O58S |
| Molecular weight | 4541.1 g/mol |
| CAS Registry Number | 9002-60-2 |
| PubChem CID | 16129617 |
| Number of residues | 39 |
| Amino acid sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Receptor / mechanism | MC2R (ACTH receptor) agonist. |
| Reported half-life | Reported ~10–20 minutes in human serum. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 14 days. |
| Clinical / regulatory status | Approved historically for research-relevant indications. |
ACTH 1-39 (Adrenocorticotropic Hormone) is a 39-amino-acid polypeptide characterised in the biochemical literature as the principal agonist at the melanocortin-2 receptor (MC2R) on the adrenal cortex. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
ACTH 1-39 is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved - do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of ACTH 1-39 we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik's records. Reported purity is consistently above 99%.
Researchers working with ACTH 1-39 often work alongside the following compounds in the preclinical literature: