Modified GHRH 1-29 analogue
The same modified GHRH backbone as CJC-1295 (DAC) but lacking the albumin-binding maleimide. ~30 minute serum half-life.
| Compound | CJC 1295 (without DAC) |
| Research category | GHRH / Secretagogue Research |
| Available sizes | 2mg, 5mg, 10mg |
| Pricing | From £25 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic GHRH analogue (Modified GRF 1-29) without DAC modification |
| Molecular formula | C152H252N44O42 |
| Molecular weight | 3367.9 g/mol |
| CAS Registry Number | 863288-34-0 |
| Number of residues | 29 |
| Amino acid sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 with D-Ala²-Gln⁸-Ala¹⁵-Leu²⁷ substitutions. |
| Receptor / mechanism | GHRH receptor agonist (modified GHRH 1-29). |
| Reported half-life | Reported ~30 minutes in human serum. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 14 days. |
| Clinical / regulatory status | Investigational research compound. |
CJC 1295 without DAC, also known in the literature as Mod GRF 1-29, is a synthetic GHRH analogue comprising the first 29 amino acids of GHRH with four amino-acid substitutions for stability. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
CJC 1295 (without DAC) is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved - do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of CJC 1295 (without DAC) we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik's records. Reported purity is consistently above 99%.
Researchers working with CJC 1295 (without DAC) often work alongside the following compounds in the preclinical literature: