GLP-1 receptor agonist · NN2211
A long-acting GLP-1 receptor agonist with palmitic-acid acylation. Once-daily research administration profile.
| Compound | Liraglutide |
| Research category | Metabolic Research |
| Available sizes | 5mg, 10mg, 30mg |
| Pricing | From £40 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic 31-amino-acid GLP-1 receptor agonist peptide (~97% homology with native GLP-1) |
| Molecular formula | C172H265N43O51 |
| Molecular weight | 3751.2 g/mol |
| CAS Registry Number | 204656-20-2 |
| PubChem CID | 16134956 |
| Number of residues | 31 |
| Amino acid sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (Lys26 acylated with γGlu-C16) |
| Receptor / mechanism | GLP-1 receptor agonist (single-target). |
| Reported half-life | Reported ~13 hours in human serum in published literature. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 28 days. |
| Clinical / regulatory status | Approved by FDA (2010) for research-relevant metabolic indications. |
Liraglutide is a synthetic GLP-1 receptor agonist with approximately 97% sequence homology to native human GLP-1. Characterised in the research literature as a lipopeptide modification of the parent sequence. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
Liraglutide is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved - do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of Liraglutide we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik's records. Reported purity is consistently above 99%.
Researchers working with Liraglutide often work alongside the following compounds in the preclinical literature:
References are independent peer-reviewed sources. Black & White Peptides Ltd is not affiliated with these publications.